PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aqcoe4G284500.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; stem eudicotyledons; Ranunculales; Ranunculaceae; Thalictroideae; Aquilegia
Family MYB
Protein Properties Length: 373aa    MW: 41248.9 Da    PI: 4.4858
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Aqcoe4G284500.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding50.25.9e-161461148
                       TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
    Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                       +g W++eEde+l +++++ G g+W++ ++  g++R++k+c++rw +yl
  Aqcoe4G284500.1.p 14 KGLWSAEEDEILRNYIEENGEGSWRSLPKNAGLNRCGKSCRLRWVNYL 61
                       678*******************************************97 PP

2Myb_DNA-binding56.75.5e-1867112148
                        TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
    Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                        rg+ T eE++++++ +++ G++ W+ Iar+++ gRt++++k++w++yl
  Aqcoe4G284500.1.p  67 RGNITSEEEDIIIKMHNKIGNR-WSVIARHLP-GRTDNEIKNHWNSYL 112
                        7999******************.*********.*************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.602.1E-20564IPR009057Homeodomain-like
PROSITE profilePS5129416.86961IPR017930Myb domain
SuperFamilySSF466891.32E-2911108IPR009057Homeodomain-like
SMARTSM007173.9E-121363IPR001005SANT/Myb domain
PfamPF002491.1E-141461IPR001005SANT/Myb domain
CDDcd001676.72E-101761No hitNo description
PROSITE profilePS5129422.162116IPR017930Myb domain
Gene3DG3DSA:1.10.10.603.5E-2365116IPR009057Homeodomain-like
SMARTSM007179.0E-1666114IPR001005SANT/Myb domain
PfamPF002491.4E-1567112IPR001005SANT/Myb domain
CDDcd001678.67E-1271112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 373 aa     Download sequence    Send to blast
MGRAPCCEKV GLNKGLWSAE EDEILRNYIE ENGEGSWRSL PKNAGLNRCG KSCRLRWVNY  60
LRGGLMRGNI TSEEEDIIIK MHNKIGNRWS VIARHLPGRT DNEIKNHWNS YLSRRIYTIR  120
RPVGESSPRT VIDTVKLDGG CKRKGQPRCR VSRKKNNHQE IPSNAEKGFI EKSFIEGGLI  180
PSMTLNKDDK ESQNAGIILN LSEEIETMSW SSSVVNGEPE NEIMGPYQGL ESCVLFTDDI  240
MDEDLLNPSD ILSLNEKDNE GQLGVLLGSS SNNNGDEGES SGGVSLSSNS TAADPAESTD  300
EWYVPFCSIA HPGEREGVVE APDNNILITD KLGDDQLLSW LWDINDSSTK EGDLFLDCDE  360
EQIKAIAGSL LS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C8e-241211625128MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002302752.26e-71hypothetical protein POPTR_0002s19920g
TrEMBLB9GSG56e-71B9GSG5_POPTR; Uncharacterized protein
STRINGPOPTR_0002s19920.12e-70(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G49330.15e-64myb domain protein 111